Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for JasperD 81. JasperD Lv 1 1 pt. 9,259
  2. Avatar for Simek 82. Simek Lv 1 1 pt. 9,205
  3. Avatar for pandapharmd 83. pandapharmd Lv 1 1 pt. 9,179
  4. Avatar for ViJay7019 84. ViJay7019 Lv 1 1 pt. 9,172
  5. Avatar for atlas100 85. atlas100 Lv 1 1 pt. 9,167
  6. Avatar for cobaltteal 86. cobaltteal Lv 1 1 pt. 9,146
  7. Avatar for jausmh 87. jausmh Lv 1 1 pt. 9,125
  8. Avatar for mitarcher 88. mitarcher Lv 1 1 pt. 9,099
  9. Avatar for Knoblerine 89. Knoblerine Lv 1 1 pt. 9,096
  10. Avatar for momadoc 90. momadoc Lv 1 1 pt. 9,089

Comments