Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612
  1. Avatar for SiCave 111. SiCave Lv 1 1 pt. 7,720
  2. Avatar for Hasuviel 112. Hasuviel Lv 1 1 pt. 7,650
  3. Avatar for Alistair69 113. Alistair69 Lv 1 1 pt. 7,647
  4. Avatar for xabxs 114. xabxs Lv 1 1 pt. 7,639
  5. Avatar for ManVsYard 115. ManVsYard Lv 1 1 pt. 7,626
  6. Avatar for Ciccillo 116. Ciccillo Lv 1 1 pt. 7,612
  7. Avatar for abnoeh 117. abnoeh Lv 1 1 pt. 7,607
  8. Avatar for Anfinsen_slept_here 118. Anfinsen_slept_here Lv 1 1 pt. 7,604
  9. Avatar for emtonsti 119. emtonsti Lv 1 1 pt. 7,600
  10. Avatar for DipsyDoodle2016 120. DipsyDoodle2016 Lv 1 1 pt. 7,598

Comments