Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612
  1. Avatar for navneetsandhu 131. navneetsandhu Lv 1 1 pt. 6,692
  2. Avatar for bkoep 132. bkoep Lv 1 1 pt. 3,334
  3. Avatar for phi16 133. phi16 Lv 1 1 pt. 3,334
  4. Avatar for rmoretti 134. rmoretti Lv 1 1 pt. 3,334
  5. Avatar for Museka 135. Museka Lv 1 1 pt. 3,334
  6. Avatar for alitzelcg 136. alitzelcg Lv 1 1 pt. 3,334
  7. Avatar for leysanguyen 137. leysanguyen Lv 1 1 pt. 3,334
  8. Avatar for AnaVillanueva18 138. AnaVillanueva18 Lv 1 1 pt. 3,334
  9. Avatar for uihcv 139. uihcv Lv 1 1 pt. 3,334
  10. Avatar for Hollinas 140. Hollinas Lv 1 1 pt. 3,334

Comments