Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612

  1. Avatar for Aubade01 11. Aubade01 Lv 1 70 pts. 9,981
  2. Avatar for reefyrob 12. reefyrob Lv 1 67 pts. 9,975
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 65 pts. 9,964
  4. Avatar for tyler0911 14. tyler0911 Lv 1 62 pts. 9,957
  5. Avatar for Mark- 15. Mark- Lv 1 60 pts. 9,957
  6. Avatar for nicobul 16. nicobul Lv 1 58 pts. 9,952
  7. Avatar for frood66 17. frood66 Lv 1 56 pts. 9,948
  8. Avatar for Galaxie 18. Galaxie Lv 1 53 pts. 9,926
  9. Avatar for anthion 19. anthion Lv 1 51 pts. 9,906
  10. Avatar for diamonddays 20. diamonddays Lv 1 49 pts. 9,896

Comments