Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612

  1. Avatar for jausmh 31. jausmh Lv 1 31 pts. 9,742
  2. Avatar for joremen 32. joremen Lv 1 30 pts. 9,735
  3. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 28 pts. 9,721
  4. Avatar for TastyMunchies 34. TastyMunchies Lv 1 27 pts. 9,719
  5. Avatar for katling 35. katling Lv 1 26 pts. 9,687
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 25 pts. 9,683
  7. Avatar for toshiue 37. toshiue Lv 1 24 pts. 9,676
  8. Avatar for silent gene 38. silent gene Lv 1 23 pts. 9,668
  9. Avatar for Glen B 39. Glen B Lv 1 22 pts. 9,647
  10. Avatar for cobaltteal 40. cobaltteal Lv 1 21 pts. 9,624

Comments