Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612

  1. Avatar for MicElephant 41. MicElephant Lv 1 20 pts. 9,610
  2. Avatar for Maerlyn138 42. Maerlyn138 Lv 1 19 pts. 9,597
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 18 pts. 9,596
  4. Avatar for Deleted player 44. Deleted player pts. 9,517
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 16 pts. 9,511
  6. Avatar for vakobo 46. vakobo Lv 1 15 pts. 9,496
  7. Avatar for heather-1 47. heather-1 Lv 1 15 pts. 9,470
  8. Avatar for DoctorSockrates 48. DoctorSockrates Lv 1 14 pts. 9,436
  9. Avatar for jobo0502 49. jobo0502 Lv 1 13 pts. 9,422
  10. Avatar for aznarog 50. aznarog Lv 1 13 pts. 9,410

Comments