Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612

  1. Avatar for orily1337 51. orily1337 Lv 1 12 pts. 9,405
  2. Avatar for Vincera 52. Vincera Lv 1 11 pts. 9,345
  3. Avatar for alcor29 53. alcor29 Lv 1 11 pts. 9,303
  4. Avatar for fpc 54. fpc Lv 1 10 pts. 9,260
  5. Avatar for weitzen 55. weitzen Lv 1 10 pts. 9,212
  6. Avatar for dbuske 56. dbuske Lv 1 9 pts. 9,192
  7. Avatar for Crossed Sticks 57. Crossed Sticks Lv 1 9 pts. 9,180
  8. Avatar for dettingen 58. dettingen Lv 1 8 pts. 9,113
  9. Avatar for pfirth 59. pfirth Lv 1 8 pts. 9,110
  10. Avatar for ReallyRatherDumb 60. ReallyRatherDumb Lv 1 7 pts. 9,046

Comments