Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612
  1. Avatar for ViJay7019 61. ViJay7019 Lv 1 7 pts. 9,012
  2. Avatar for cbwest 62. cbwest Lv 1 7 pts. 8,986
  3. Avatar for RootBeerSwordsman 63. RootBeerSwordsman Lv 1 6 pts. 8,945
  4. Avatar for Jesse Pinkman 64. Jesse Pinkman Lv 1 6 pts. 8,846
  5. Avatar for kludbrook 65. kludbrook Lv 1 6 pts. 8,826
  6. Avatar for jebbiek 66. jebbiek Lv 1 5 pts. 8,826
  7. Avatar for peanutbutterwithhoney 67. peanutbutterwithhoney Lv 1 5 pts. 8,795
  8. Avatar for Superphosphate 68. Superphosphate Lv 1 5 pts. 8,788
  9. Avatar for sciencewalker 69. sciencewalker Lv 1 4 pts. 8,764
  10. Avatar for SouperGenious 70. SouperGenious Lv 1 4 pts. 8,701

Comments