Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612
  1. Avatar for leehaggis 71. leehaggis Lv 1 4 pts. 8,693
  2. Avatar for lconor 72. lconor Lv 1 4 pts. 8,684
  3. Avatar for theonlyperuvian 73. theonlyperuvian Lv 1 3 pts. 8,665
  4. Avatar for Merf 74. Merf Lv 1 3 pts. 8,639
  5. Avatar for Sci1217 75. Sci1217 Lv 1 3 pts. 8,635
  6. Avatar for rinze 76. rinze Lv 1 3 pts. 8,606
  7. Avatar for Altercomp 77. Altercomp Lv 1 3 pts. 8,594
  8. Avatar for frostschutz 78. frostschutz Lv 1 3 pts. 8,592
  9. Avatar for hada 79. hada Lv 1 2 pts. 8,583
  10. Avatar for justjustin 80. justjustin Lv 1 2 pts. 8,572

Comments