Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 10,101
  2. Avatar for Contenders 2. Contenders 63 pts. 10,091
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 10,083
  4. Avatar for Go Science 4. Go Science 21 pts. 10,031
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 9,998
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,952
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,906
  8. Avatar for Russian team 8. Russian team 1 pt. 9,496
  9. Avatar for freefolder 9. freefolder 1 pt. 8,594
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,518
  1. Avatar for pandapharmd 91. pandapharmd Lv 1 1 pt. 8,324
  2. Avatar for Sydefecks 92. Sydefecks Lv 1 1 pt. 8,310
  3. Avatar for Perhonen 93. Perhonen Lv 1 1 pt. 8,284
  4. Avatar for boondog 94. boondog Lv 1 1 pt. 8,230
  5. Avatar for Psych0Active 95. Psych0Active Lv 1 1 pt. 8,102
  6. Avatar for greenturtle1134 96. greenturtle1134 Lv 1 1 pt. 8,096
  7. Avatar for kasper2421 97. kasper2421 Lv 1 1 pt. 8,038
  8. Avatar for JSmith48 98. JSmith48 Lv 1 1 pt. 8,018
  9. Avatar for rabamino12358 99. rabamino12358 Lv 1 1 pt. 8,002
  10. Avatar for bitwave 100. bitwave Lv 1 1 pt. 7,998

Comments