Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Marvin's bunch 100 pts. 10,101
  2. Avatar for Contenders 2. Contenders 63 pts. 10,091
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 10,083
  4. Avatar for Go Science 4. Go Science 21 pts. 10,031
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 9,998
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,952
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,906
  8. Avatar for Russian team 8. Russian team 1 pt. 9,496
  9. Avatar for freefolder 9. freefolder 1 pt. 8,594
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,518

  1. Avatar for izzgood 121. izzgood Lv 1 1 pt. 7,581
  2. Avatar for wouterenkinga 122. wouterenkinga Lv 1 1 pt. 7,497
  3. Avatar for gurch 123. gurch Lv 1 1 pt. 7,490
  4. Avatar for fexwambasaurio 124. fexwambasaurio Lv 1 1 pt. 7,369
  5. Avatar for Hufalar_Nicdao_Yu 125. Hufalar_Nicdao_Yu Lv 1 1 pt. 7,365
  6. Avatar for flor-flor 126. flor-flor Lv 1 1 pt. 7,357
  7. Avatar for khendarg 127. khendarg Lv 1 1 pt. 7,076
  8. Avatar for rkon13 128. rkon13 Lv 1 1 pt. 6,894
  9. Avatar for Marvelz 129. Marvelz Lv 1 1 pt. 6,877
  10. Avatar for 01010011111 130. 01010011111 Lv 1 1 pt. 6,740

Comments