Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,771
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 10,658
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,658
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 90 pts. 10,657
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 87 pts. 10,653
  6. Avatar for Galaxie 6. Galaxie Lv 1 84 pts. 10,626
  7. Avatar for pauldunn 7. pauldunn Lv 1 81 pts. 10,611
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 78 pts. 10,608
  9. Avatar for smilingone 9. smilingone Lv 1 75 pts. 10,584
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 72 pts. 10,561

Comments