Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,771
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 10,658
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,658
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 90 pts. 10,657
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 87 pts. 10,653
  6. Avatar for Galaxie 6. Galaxie Lv 1 84 pts. 10,626
  7. Avatar for pauldunn 7. pauldunn Lv 1 81 pts. 10,611
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 78 pts. 10,608
  9. Avatar for smilingone 9. smilingone Lv 1 75 pts. 10,584
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 72 pts. 10,561

Comments