Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003
  1. Avatar for silent gene 11. silent gene Lv 1 2 pts. 10,625
  2. Avatar for frostschutz 12. frostschutz Lv 1 1 pt. 10,601
  3. Avatar for Deleted player 13. Deleted player pts. 10,585
  4. Avatar for robgee 14. robgee Lv 1 1 pt. 10,579
  5. Avatar for pauldunn 15. pauldunn Lv 1 1 pt. 10,545
  6. Avatar for jausmh 16. jausmh Lv 1 1 pt. 10,445
  7. Avatar for georg137 17. georg137 Lv 1 1 pt. 10,358
  8. Avatar for ViJay7019 18. ViJay7019 Lv 1 1 pt. 10,170
  9. Avatar for dbuske 19. dbuske Lv 1 1 pt. 9,984

Comments