Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003

  1. Avatar for khendarg 131. khendarg Lv 1 1 pt. 7,207
  2. Avatar for rmoretti 132. rmoretti Lv 1 1 pt. 5,966
  3. Avatar for liamfratturo 133. liamfratturo Lv 1 1 pt. 4,734
  4. Avatar for Abdilradov Madiyar 134. Abdilradov Madiyar Lv 1 1 pt. 4,734
  5. Avatar for Aranza L 135. Aranza L Lv 1 1 pt. 4,734
  6. Avatar for kcoleman 136. kcoleman Lv 1 1 pt. 4,734
  7. Avatar for Sugaroid 137. Sugaroid Lv 1 1 pt. 4,734
  8. Avatar for Hollinas 138. Hollinas Lv 1 1 pt. 4,734
  9. Avatar for picollo 139. picollo Lv 1 1 pt. 4,734

Comments