Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 0
  1. Avatar for rudolfwalter 101. rudolfwalter Lv 1 1 pt. 5,259
  2. Avatar for Jasonsham 102. Jasonsham Lv 1 1 pt. 4,697
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 1 pt. 4,607
  4. Avatar for kludbrook 104. kludbrook Lv 1 1 pt. 4,491
  5. Avatar for Schiddy 105. Schiddy Lv 1 1 pt. 4,311
  6. Avatar for NotJim99 106. NotJim99 Lv 1 1 pt. 4,139
  7. Avatar for helpmeplease 107. helpmeplease Lv 1 1 pt. 4,103
  8. Avatar for YorPrints 108. YorPrints Lv 1 1 pt. 4,088
  9. Avatar for leehaggis 109. leehaggis Lv 1 1 pt. 3,740
  10. Avatar for quinbai 110. quinbai Lv 1 1 pt. 2,412

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV