Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for rudolfwalter 101. rudolfwalter Lv 1 1 pt. 5,259
  2. Avatar for Jasonsham 102. Jasonsham Lv 1 1 pt. 4,697
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 1 pt. 4,607
  4. Avatar for kludbrook 104. kludbrook Lv 1 1 pt. 4,491
  5. Avatar for Schiddy 105. Schiddy Lv 1 1 pt. 4,311
  6. Avatar for NotJim99 106. NotJim99 Lv 1 1 pt. 4,139
  7. Avatar for helpmeplease 107. helpmeplease Lv 1 1 pt. 4,103
  8. Avatar for YorPrints 108. YorPrints Lv 1 1 pt. 4,088
  9. Avatar for leehaggis 109. leehaggis Lv 1 1 pt. 3,740
  10. Avatar for quinbai 110. quinbai Lv 1 1 pt. 2,412

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV