Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 0
  1. Avatar for robgee 11. robgee Lv 1 68 pts. 11,770
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 65 pts. 11,730
  3. Avatar for jobo0502 13. jobo0502 Lv 1 62 pts. 11,718
  4. Avatar for Mark- 14. Mark- Lv 1 60 pts. 11,636
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 57 pts. 11,625
  6. Avatar for Vinara 16. Vinara Lv 1 55 pts. 11,592
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 52 pts. 11,559
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 50 pts. 11,543
  9. Avatar for silent gene 19. silent gene Lv 1 48 pts. 11,533
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 46 pts. 11,500

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV