1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Summary

• Created: October 01, 2018
• Expires: October 09, 2018 at 10:00 UTC
• Max points: 100

Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

• 1. Beta Folders 100 pts. 12,453
• 2. Anthropic Dreams 71 pts. 12,429
• 3. Contenders 49 pts. 12,029
• 4. Go Science 33 pts. 11,885
• 5. L'Alliance Francophone 22 pts. 11,730
• 6. Void Crushers 14 pts. 11,543
• 7. Marvin's bunch 8 pts. 11,450
• 8. HMT heritage 5 pts. 10,510
• 9. Gargleblasters 3 pts. 9,924
• 10. freefolder 2 pts. 8,408

Top soloists

• 11. robgee 68 pts. 11,770
• 12. christioanchauvin 65 pts. 11,730
• 13. jobo0502 62 pts. 11,718
• 14. Mark- 60 pts. 11,636
• 15. fiendish_ghoul 57 pts. 11,625
• 16. Vinara 55 pts. 11,592
• 17. TastyMunchies 52 pts. 11,559
• 18. Timo van der Laan 50 pts. 11,543
• 19. silent gene 48 pts. 11,533
• 20. Bletchley Park 46 pts. 11,500

Comments

[Bletchley Park]

This puzzle is not showing up in the puzzle download menu. 20180829-6ed3ad0d20-win_x86

[frood66]

where is the sequence - not shown on this page (which is de rigour these days)

[Susume]

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

[beta_helix]

Many people have been able to play this one, are you still getting that error?

[beta_helix]

Thank you Susume for posting it so quickly!

[Bletchley Park]

I can now load it, thank you !

[beta_helix]

I believe that sometimes it posts to the website but takes longer to sync up with the client.