Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0

  1. Avatar for jausmh 21. jausmh Lv 1 44 pts. 11,450
  2. Avatar for Glen B 22. Glen B Lv 1 42 pts. 11,372
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 40 pts. 11,213
  4. Avatar for johnmitch 24. johnmitch Lv 1 38 pts. 11,178
  5. Avatar for frood66 25. frood66 Lv 1 37 pts. 10,953
  6. Avatar for weitzen 26. weitzen Lv 1 35 pts. 10,891
  7. Avatar for orily1337 27. orily1337 Lv 1 33 pts. 10,889
  8. Avatar for isaksson 28. isaksson Lv 1 32 pts. 10,878
  9. Avatar for nicobul 29. nicobul Lv 1 30 pts. 10,684
  10. Avatar for spvincent 30. spvincent Lv 1 29 pts. 10,674

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV