Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408
  1. Avatar for jausmh 21. jausmh Lv 1 44 pts. 11,450
  2. Avatar for Glen B 22. Glen B Lv 1 42 pts. 11,372
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 40 pts. 11,213
  4. Avatar for johnmitch 24. johnmitch Lv 1 38 pts. 11,178
  5. Avatar for frood66 25. frood66 Lv 1 37 pts. 10,953
  6. Avatar for weitzen 26. weitzen Lv 1 35 pts. 10,891
  7. Avatar for orily1337 27. orily1337 Lv 1 33 pts. 10,889
  8. Avatar for isaksson 28. isaksson Lv 1 32 pts. 10,878
  9. Avatar for nicobul 29. nicobul Lv 1 30 pts. 10,684
  10. Avatar for spvincent 30. spvincent Lv 1 29 pts. 10,674

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV