Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 0
  1. Avatar for manu8170 41. manu8170 Lv 1 16 pts. 9,968
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 16 pts. 9,953
  3. Avatar for anthion 43. anthion Lv 1 15 pts. 9,924
  4. Avatar for QuantumDeveloper 44. QuantumDeveloper Lv 1 14 pts. 9,901
  5. Avatar for georg137 45. georg137 Lv 1 13 pts. 9,896
  6. Avatar for Blipperman 46. Blipperman Lv 1 12 pts. 9,640
  7. Avatar for Amphimixus 47. Amphimixus Lv 1 12 pts. 9,630
  8. Avatar for stomjoh 48. stomjoh Lv 1 11 pts. 9,434
  9. Avatar for drumpeter18yrs9yrs 49. drumpeter18yrs9yrs Lv 1 10 pts. 9,410
  10. Avatar for rabamino12358 50. rabamino12358 Lv 1 10 pts. 9,368

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV