Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for manu8170 41. manu8170 Lv 1 16 pts. 9,968
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 16 pts. 9,953
  3. Avatar for anthion 43. anthion Lv 1 15 pts. 9,924
  4. Avatar for QuantumDeveloper 44. QuantumDeveloper Lv 1 14 pts. 9,901
  5. Avatar for georg137 45. georg137 Lv 1 13 pts. 9,896
  6. Avatar for Blipperman 46. Blipperman Lv 1 12 pts. 9,640
  7. Avatar for Amphimixus 47. Amphimixus Lv 1 12 pts. 9,630
  8. Avatar for stomjoh 48. stomjoh Lv 1 11 pts. 9,434
  9. Avatar for drumpeter18yrs9yrs 49. drumpeter18yrs9yrs Lv 1 10 pts. 9,410
  10. Avatar for rabamino12358 50. rabamino12358 Lv 1 10 pts. 9,368

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV