Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 0
  1. Avatar for alwen 71. alwen Lv 1 3 pts. 7,833
  2. Avatar for momadoc 72. momadoc Lv 1 2 pts. 7,765
  3. Avatar for gldisater 73. gldisater Lv 1 2 pts. 7,737
  4. Avatar for frostschutz 74. frostschutz Lv 1 2 pts. 7,706
  5. Avatar for ImmaFOLDyou 75. ImmaFOLDyou Lv 1 2 pts. 7,584
  6. Avatar for hikarinotomadoi 76. hikarinotomadoi Lv 1 2 pts. 7,569
  7. Avatar for mitarcher 77. mitarcher Lv 1 2 pts. 7,505
  8. Avatar for cbwest 78. cbwest Lv 1 2 pts. 7,500
  9. Avatar for Museka 79. Museka Lv 1 2 pts. 7,464
  10. Avatar for alyssa_d 80. alyssa_d Lv 1 1 pt. 7,400

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV