Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408
  1. Avatar for alwen 71. alwen Lv 1 3 pts. 7,833
  2. Avatar for momadoc 72. momadoc Lv 1 2 pts. 7,765
  3. Avatar for gldisater 73. gldisater Lv 1 2 pts. 7,737
  4. Avatar for frostschutz 74. frostschutz Lv 1 2 pts. 7,706
  5. Avatar for ImmaFOLDyou 75. ImmaFOLDyou Lv 1 2 pts. 7,584
  6. Avatar for hikarinotomadoi 76. hikarinotomadoi Lv 1 2 pts. 7,569
  7. Avatar for mitarcher 77. mitarcher Lv 1 2 pts. 7,505
  8. Avatar for cbwest 78. cbwest Lv 1 2 pts. 7,500
  9. Avatar for Museka 79. Museka Lv 1 2 pts. 7,464
  10. Avatar for alyssa_d 80. alyssa_d Lv 1 1 pt. 7,400

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV