Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 0
  1. Avatar for sciencewalker 81. sciencewalker Lv 1 1 pt. 7,380
  2. Avatar for ClassicShyGuy 82. ClassicShyGuy Lv 1 1 pt. 7,311
  3. Avatar for ManVsYard 83. ManVsYard Lv 1 1 pt. 7,273
  4. Avatar for atlas100 84. atlas100 Lv 1 1 pt. 7,204
  5. Avatar for Deleted player 85. Deleted player pts. 7,172
  6. Avatar for blockr2000 86. blockr2000 Lv 1 1 pt. 6,984
  7. Avatar for 181818 87. 181818 Lv 1 1 pt. 6,942
  8. Avatar for multaq 88. multaq Lv 1 1 pt. 6,912
  9. Avatar for dbuske 89. dbuske Lv 1 1 pt. 6,896
  10. Avatar for picollo 90. picollo Lv 1 1 pt. 6,556

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV