Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408
  1. Avatar for sciencewalker 81. sciencewalker Lv 1 1 pt. 7,380
  2. Avatar for ClassicShyGuy 82. ClassicShyGuy Lv 1 1 pt. 7,311
  3. Avatar for ManVsYard 83. ManVsYard Lv 1 1 pt. 7,273
  4. Avatar for atlas100 84. atlas100 Lv 1 1 pt. 7,204
  5. Avatar for Deleted player 85. Deleted player pts. 7,172
  6. Avatar for blockr2000 86. blockr2000 Lv 1 1 pt. 6,984
  7. Avatar for 181818 87. 181818 Lv 1 1 pt. 6,942
  8. Avatar for multaq 88. multaq Lv 1 1 pt. 6,912
  9. Avatar for dbuske 89. dbuske Lv 1 1 pt. 6,896
  10. Avatar for picollo 90. picollo Lv 1 1 pt. 6,556

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV