Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,763
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 8,711
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,709
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,652
  5. Avatar for freefolder 15. freefolder 1 pt. 8,333

  1. Avatar for kdratstn 132. kdratstn Lv 1 1 pt. 7,130
  2. Avatar for acole001 133. acole001 Lv 1 1 pt. 7,090
  3. Avatar for Vincera 134. Vincera Lv 1 1 pt. 6,810
  4. Avatar for 2707 135. 2707 Lv 1 1 pt. 6,545
  5. Avatar for pauldunn 136. pauldunn Lv 1 1 pt. 0
  6. Avatar for nasalam2000 137. nasalam2000 Lv 1 1 pt. 0
  7. Avatar for OliveTree 138. OliveTree Lv 1 1 pt. 0
  8. Avatar for JellyJump 139. JellyJump Lv 1 1 pt. 0

Comments