Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,763
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 8,711
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,709
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,652
  5. Avatar for freefolder 15. freefolder 1 pt. 8,333
  6. Avatar for Weber Tropical Diseases 16. Weber Tropical Diseases 1 pt. 7,543
  1. Avatar for altejoh 11. altejoh Lv 1 69 pts. 10,144
  2. Avatar for Glen B 12. Glen B Lv 1 67 pts. 10,124
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 64 pts. 10,115
  4. Avatar for Blipperman 14. Blipperman Lv 1 61 pts. 10,107
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 59 pts. 10,096
  6. Avatar for pvc78 16. pvc78 Lv 1 57 pts. 10,060
  7. Avatar for joremen 17. joremen Lv 1 55 pts. 10,017
  8. Avatar for tyler0911 18. tyler0911 Lv 1 52 pts. 10,011
  9. Avatar for actiasluna 19. actiasluna Lv 1 50 pts. 10,006
  10. Avatar for jobo0502 20. jobo0502 Lv 1 48 pts. 10,006

Comments