Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,763
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 8,711
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,709
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,652
  5. Avatar for freefolder 15. freefolder 1 pt. 8,333
  6. Avatar for Weber Tropical Diseases 16. Weber Tropical Diseases 1 pt. 7,543
  1. Avatar for jamiexq 51. jamiexq Lv 1 11 pts. 9,634
  2. Avatar for anthion 52. anthion Lv 1 10 pts. 9,622
  3. Avatar for johnmitch 53. johnmitch Lv 1 10 pts. 9,594
  4. Avatar for Crossed Sticks 54. Crossed Sticks Lv 1 9 pts. 9,556
  5. Avatar for toshiue 55. toshiue Lv 1 9 pts. 9,543
  6. Avatar for manu8170 56. manu8170 Lv 1 8 pts. 9,536
  7. Avatar for orily1337 57. orily1337 Lv 1 8 pts. 9,516
  8. Avatar for pfirth 58. pfirth Lv 1 7 pts. 9,498
  9. Avatar for cbwest 59. cbwest Lv 1 7 pts. 9,455
  10. Avatar for MicElephant 60. MicElephant Lv 1 7 pts. 9,446

Comments