Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,763
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 8,711
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,709
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,652
  5. Avatar for freefolder 15. freefolder 1 pt. 8,333
  6. Avatar for Weber Tropical Diseases 16. Weber Tropical Diseases 1 pt. 7,543
  1. Avatar for heather-1 61. heather-1 Lv 1 6 pts. 9,369
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 6 pts. 9,334
  3. Avatar for DoctorSockrates 63. DoctorSockrates Lv 1 6 pts. 9,302
  4. Avatar for aznarog 64. aznarog Lv 1 5 pts. 9,289
  5. Avatar for alcor29 65. alcor29 Lv 1 5 pts. 9,288
  6. Avatar for 181818 66. 181818 Lv 1 5 pts. 9,277
  7. Avatar for ourtown 67. ourtown Lv 1 4 pts. 9,274
  8. Avatar for katling 68. katling Lv 1 4 pts. 9,226
  9. Avatar for Hellcat6 69. Hellcat6 Lv 1 4 pts. 9,221
  10. Avatar for dbuske 70. dbuske Lv 1 4 pts. 9,207

Comments