Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,763
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 8,711
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,709
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,652
  5. Avatar for freefolder 15. freefolder 1 pt. 8,333
  6. Avatar for Weber Tropical Diseases 16. Weber Tropical Diseases 1 pt. 7,543
  1. Avatar for Deleted player 71. Deleted player pts. 9,192
  2. Avatar for WBarme1234 72. WBarme1234 Lv 1 3 pts. 9,133
  3. Avatar for weitzen 73. weitzen Lv 1 3 pts. 9,128
  4. Avatar for Deleted player 74. Deleted player pts. 9,106
  5. Avatar for cobaltteal 75. cobaltteal Lv 1 3 pts. 9,016
  6. Avatar for SKSbell 76. SKSbell Lv 1 2 pts. 8,933
  7. Avatar for Merf 77. Merf Lv 1 2 pts. 8,930
  8. Avatar for kyky 78. kyky Lv 1 2 pts. 8,843
  9. Avatar for Savas 79. Savas Lv 1 2 pts. 8,794
  10. Avatar for dd-2 80. dd-2 Lv 1 2 pts. 8,775

Comments