Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295

  1. Avatar for pfirth 91. pfirth Lv 1 1 pt. 8,203
  2. Avatar for kludbrook 92. kludbrook Lv 1 1 pt. 8,175
  3. Avatar for sjgifford 93. sjgifford Lv 1 1 pt. 8,134
  4. Avatar for GUANINJIN 94. GUANINJIN Lv 1 1 pt. 8,094
  5. Avatar for aspadistra 95. aspadistra Lv 1 1 pt. 7,962
  6. Avatar for preponi 96. preponi Lv 1 1 pt. 7,954
  7. Avatar for 01010011111 97. 01010011111 Lv 1 1 pt. 7,946
  8. Avatar for roman madala 98. roman madala Lv 1 1 pt. 7,883
  9. Avatar for alyssajoyh 99. alyssajoyh Lv 1 1 pt. 7,872
  10. Avatar for wastracene42 100. wastracene42 Lv 1 1 pt. 7,859

Comments