Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for 181818 101. 181818 Lv 1 1 pt. 7,853
  2. Avatar for kbill974 102. kbill974 Lv 1 1 pt. 7,830
  3. Avatar for leehaggis 103. leehaggis Lv 1 1 pt. 7,827
  4. Avatar for DNAgenius 104. DNAgenius Lv 1 1 pt. 7,678
  5. Avatar for Grom 105. Grom Lv 1 1 pt. 7,634
  6. Avatar for AndrewMcClure 106. AndrewMcClure Lv 1 1 pt. 7,589
  7. Avatar for momadoc 107. momadoc Lv 1 1 pt. 7,486
  8. Avatar for Biyokimya_2018_Cengizhan 108. Biyokimya_2018_Cengizhan Lv 1 1 pt. 7,401
  9. Avatar for learp 109. learp Lv 1 1 pt. 7,385
  10. Avatar for ivalnic 110. ivalnic Lv 1 1 pt. 7,357

Comments