Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for RYDER997 111. RYDER997 Lv 1 1 pt. 7,320
  2. Avatar for aamilan 112. aamilan Lv 1 1 pt. 7,305
  3. Avatar for Altercomp 113. Altercomp Lv 1 1 pt. 7,295
  4. Avatar for jshee 114. jshee Lv 1 1 pt. 7,263
  5. Avatar for u.w. 115. u.w. Lv 1 1 pt. 7,228
  6. Avatar for Paulo Roque 116. Paulo Roque Lv 1 1 pt. 7,210
  7. Avatar for Dr.Otterpop 117. Dr.Otterpop Lv 1 1 pt. 7,157
  8. Avatar for hansvandenhof 118. hansvandenhof Lv 1 1 pt. 7,136
  9. Avatar for Gahmeir 119. Gahmeir Lv 1 1 pt. 7,058
  10. Avatar for Deleted player 120. Deleted player 1 pt. 7,052

Comments