Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295

  1. Avatar for lvanonse 121. lvanonse Lv 1 1 pt. 6,968
  2. Avatar for lamoille 122. lamoille Lv 1 1 pt. 6,904
  3. Avatar for Museka 123. Museka Lv 1 1 pt. 6,867
  4. Avatar for Sydefecks 124. Sydefecks Lv 1 1 pt. 6,858
  5. Avatar for Deleted player 125. Deleted player pts. 6,798
  6. Avatar for Ricardo Oliveira 126. Ricardo Oliveira Lv 1 1 pt. 6,701
  7. Avatar for khendarg 127. khendarg Lv 1 1 pt. 6,591
  8. Avatar for lanyingjie 128. lanyingjie Lv 1 1 pt. 6,575
  9. Avatar for csizi3 129. csizi3 Lv 1 1 pt. 6,506
  10. Avatar for ghiggins 130. ghiggins Lv 1 1 pt. 6,456

Comments