Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for JellyJump 131. JellyJump Lv 1 1 pt. 0
  2. Avatar for Hollinas 132. Hollinas Lv 1 1 pt. 0
  3. Avatar for Vedran 133. Vedran Lv 1 1 pt. 0
  4. Avatar for YGK 134. YGK Lv 1 1 pt. 0
  5. Avatar for toshiue 135. toshiue Lv 1 1 pt. 0
  6. Avatar for xorb946 136. xorb946 Lv 1 1 pt. 0
  7. Avatar for rmoretti 137. rmoretti Lv 1 1 pt. 0

Comments