Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295

  1. Avatar for actiasluna 11. actiasluna Lv 1 69 pts. 10,079
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 66 pts. 10,058
  3. Avatar for jobo0502 13. jobo0502 Lv 1 64 pts. 10,058
  4. Avatar for Galaxie 14. Galaxie Lv 1 61 pts. 10,041
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 59 pts. 10,040
  6. Avatar for reefyrob 16. reefyrob Lv 1 56 pts. 10,015
  7. Avatar for Glen B 17. Glen B Lv 1 54 pts. 10,001
  8. Avatar for pauldunn 18. pauldunn Lv 1 52 pts. 9,966
  9. Avatar for DoctorSockrates 19. DoctorSockrates Lv 1 50 pts. 9,932
  10. Avatar for pvc78 20. pvc78 Lv 1 48 pts. 9,919

Comments