Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for Flagg65a 31. Flagg65a Lv 1 29 pts. 9,700
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 28 pts. 9,695
  3. Avatar for diamonddays 33. diamonddays Lv 1 27 pts. 9,684
  4. Avatar for smilingone 34. smilingone Lv 1 25 pts. 9,680
  5. Avatar for jamiexq 35. jamiexq Lv 1 24 pts. 9,657
  6. Avatar for jausmh 36. jausmh Lv 1 23 pts. 9,641
  7. Avatar for georg137 37. georg137 Lv 1 22 pts. 9,631
  8. Avatar for Bletchley Park 38. Bletchley Park Lv 1 21 pts. 9,607
  9. Avatar for Jesse Pinkman 39. Jesse Pinkman Lv 1 20 pts. 9,571
  10. Avatar for guineapig 40. guineapig Lv 1 19 pts. 9,554

Comments