Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for firejuggler 51. firejuggler Lv 1 11 pts. 9,332
  2. Avatar for TastyMunchies 52. TastyMunchies Lv 1 10 pts. 9,312
  3. Avatar for anthion 53. anthion Lv 1 9 pts. 9,255
  4. Avatar for dbuske 54. dbuske Lv 1 9 pts. 9,241
  5. Avatar for cbwest 55. cbwest Lv 1 8 pts. 9,203
  6. Avatar for mitarcher 56. mitarcher Lv 1 8 pts. 9,147
  7. Avatar for froggs554 57. froggs554 Lv 1 8 pts. 9,131
  8. Avatar for altejoh 58. altejoh Lv 1 7 pts. 9,102
  9. Avatar for SKSbell 59. SKSbell Lv 1 7 pts. 9,085
  10. Avatar for petetrig 60. petetrig Lv 1 6 pts. 9,084

Comments