Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for vakobo 61. vakobo Lv 1 6 pts. 8,958
  2. Avatar for fpc 62. fpc Lv 1 6 pts. 8,942
  3. Avatar for ppp6 63. ppp6 Lv 1 5 pts. 8,917
  4. Avatar for alyssa_d 64. alyssa_d Lv 1 5 pts. 8,911
  5. Avatar for Squirrely 65. Squirrely Lv 1 5 pts. 8,909
  6. Avatar for Deleted player 66. Deleted player pts. 8,854
  7. Avatar for Hellcat6 67. Hellcat6 Lv 1 4 pts. 8,837
  8. Avatar for ViJay7019 68. ViJay7019 Lv 1 4 pts. 8,817
  9. Avatar for Merf 69. Merf Lv 1 4 pts. 8,747
  10. Avatar for YeshuaLives 70. YeshuaLives Lv 1 3 pts. 8,740

Comments