Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295

  1. Avatar for RyeSnake 71. RyeSnake Lv 1 3 pts. 8,681
  2. Avatar for Deleted player 72. Deleted player pts. 8,681
  3. Avatar for ourtown 73. ourtown Lv 1 3 pts. 8,657
  4. Avatar for fisherlr777 74. fisherlr777 Lv 1 3 pts. 8,651
  5. Avatar for Knoblerine 75. Knoblerine Lv 1 2 pts. 8,626
  6. Avatar for katling 76. katling Lv 1 2 pts. 8,597
  7. Avatar for Amphimixus 77. Amphimixus Lv 1 2 pts. 8,577
  8. Avatar for rezaefar 78. rezaefar Lv 1 2 pts. 8,541
  9. Avatar for zid 79. zid Lv 1 2 pts. 8,502
  10. Avatar for icaru-5 80. icaru-5 Lv 1 2 pts. 8,494

Comments