Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for boondog 81. boondog Lv 1 2 pts. 8,459
  2. Avatar for Marvelz 82. Marvelz Lv 1 2 pts. 8,423
  3. Avatar for justjustin 83. justjustin Lv 1 1 pt. 8,367
  4. Avatar for multaq 84. multaq Lv 1 1 pt. 8,364
  5. Avatar for Technetium 85. Technetium Lv 1 1 pt. 8,356
  6. Avatar for rinze 86. rinze Lv 1 1 pt. 8,331
  7. Avatar for rabamino12358 87. rabamino12358 Lv 1 1 pt. 8,287
  8. Avatar for joaniegirl 88. joaniegirl Lv 1 1 pt. 8,239
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 1 pt. 8,213
  10. Avatar for Znaika 90. Znaika Lv 1 1 pt. 8,205

Comments