Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378
  1. Avatar for wojto.htc 131. wojto.htc Lv 1 1 pt. 6,845
  2. Avatar for sitlux 132. sitlux Lv 1 1 pt. 6,796
  3. Avatar for 01010011111 133. 01010011111 Lv 1 1 pt. 6,768
  4. Avatar for jflat06 134. jflat06 Lv 1 1 pt. 6,446
  5. Avatar for brow42 135. brow42 Lv 1 1 pt. 5,947
  6. Avatar for Susume 136. Susume Lv 1 1 pt. 4,740
  7. Avatar for Marvelz 137. Marvelz Lv 1 1 pt. 4,638
  8. Avatar for rmoretti 138. rmoretti Lv 1 1 pt. 3,379
  9. Avatar for JuliaAshley 139. JuliaAshley Lv 1 1 pt. 3,378
  10. Avatar for roelria 140. roelria Lv 1 1 pt. 3,378

Comments