Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288

  1. Avatar for tyler0911
    1. tyler0911 Lv 1
    100 pts. 9,881
  2. Avatar for Aubade01 2. Aubade01 Lv 1 97 pts. 9,854
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 94 pts. 9,844
  4. Avatar for johnmitch 4. johnmitch Lv 1 91 pts. 9,830
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 88 pts. 9,783
  6. Avatar for actiasluna 6. actiasluna Lv 1 85 pts. 9,765
  7. Avatar for silent gene 7. silent gene Lv 1 82 pts. 9,759
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 79 pts. 9,739
  9. Avatar for LociOiling 9. LociOiling Lv 1 76 pts. 9,738
  10. Avatar for Galaxie 10. Galaxie Lv 1 74 pts. 9,727

Comments