Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378

  1. Avatar for robgee 11. robgee Lv 1 71 pts. 9,719
  2. Avatar for frood66 12. frood66 Lv 1 68 pts. 9,696
  3. Avatar for crpainter 13. crpainter Lv 1 66 pts. 9,675
  4. Avatar for Vinara 14. Vinara Lv 1 64 pts. 9,657
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 61 pts. 9,642
  6. Avatar for reefyrob 16. reefyrob Lv 1 59 pts. 9,634
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 57 pts. 9,609
  8. Avatar for nicobul 18. nicobul Lv 1 55 pts. 9,603
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 53 pts. 9,587
  10. Avatar for YeshuaLives 20. YeshuaLives Lv 1 51 pts. 9,586

Comments