Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378
  1. Avatar for MicElephant 21. MicElephant Lv 1 49 pts. 9,574
  2. Avatar for Blipperman 22. Blipperman Lv 1 47 pts. 9,574
  3. Avatar for pvc78 23. pvc78 Lv 1 45 pts. 9,562
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 43 pts. 9,561
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 42 pts. 9,550
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 40 pts. 9,537
  7. Avatar for manu8170 27. manu8170 Lv 1 39 pts. 9,537
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 37 pts. 9,534
  9. Avatar for fpc 29. fpc Lv 1 36 pts. 9,517
  10. Avatar for Mark- 30. Mark- Lv 1 34 pts. 9,512

Comments