Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378
  1. Avatar for diamonddays 31. diamonddays Lv 1 33 pts. 9,474
  2. Avatar for jamiexq 32. jamiexq Lv 1 31 pts. 9,463
  3. Avatar for Maerlyn138 33. Maerlyn138 Lv 1 30 pts. 9,429
  4. Avatar for O Seki To 34. O Seki To Lv 1 29 pts. 9,428
  5. Avatar for christioanchauvin 35. christioanchauvin Lv 1 28 pts. 9,411
  6. Avatar for Hellcat6 36. Hellcat6 Lv 1 26 pts. 9,376
  7. Avatar for phi16 37. phi16 Lv 1 25 pts. 9,374
  8. Avatar for weitzen 38. weitzen Lv 1 24 pts. 9,370
  9. Avatar for guineapig 39. guineapig Lv 1 23 pts. 9,369
  10. Avatar for jobo0502 40. jobo0502 Lv 1 22 pts. 9,365

Comments