Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,689
  2. Avatar for freefolder 12. freefolder 1 pt. 8,542
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,191
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,312
  5. Avatar for Window Group 15. Window Group 1 pt. 6,446
  6. Avatar for SRHS AP Biology 16. SRHS AP Biology 1 pt. 3,378
  1. Avatar for tarimo 41. tarimo Lv 1 21 pts. 9,344
  2. Avatar for DoctorSockrates 42. DoctorSockrates Lv 1 20 pts. 9,339
  3. Avatar for anthion 43. anthion Lv 1 19 pts. 9,331
  4. Avatar for isaksson 44. isaksson Lv 1 18 pts. 9,320
  5. Avatar for georg137 45. georg137 Lv 1 18 pts. 9,307
  6. Avatar for vakobo 46. vakobo Lv 1 17 pts. 9,288
  7. Avatar for Deleted player 47. Deleted player pts. 9,247
  8. Avatar for cobaltteal 48. cobaltteal Lv 1 15 pts. 9,220
  9. Avatar for Skippysk8s 49. Skippysk8s Lv 1 15 pts. 9,147
  10. Avatar for aznarog 50. aznarog Lv 1 14 pts. 9,130

Comments