1593: Revisiting Puzzle 84: Giant Anemone
Closed since over 7 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- October 29, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Top groups
Comments