Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,867
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 9,833
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 9,800
  4. Avatar for nicobul 4. nicobul Lv 1 90 pts. 9,780
  5. Avatar for actiasluna 5. actiasluna Lv 1 87 pts. 9,777
  6. Avatar for LociOiling 6. LociOiling Lv 1 84 pts. 9,773
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 81 pts. 9,769
  8. Avatar for johnmitch 8. johnmitch Lv 1 78 pts. 9,760
  9. Avatar for Blipperman 9. Blipperman Lv 1 75 pts. 9,745
  10. Avatar for jobo0502 10. jobo0502 Lv 1 72 pts. 9,713

Comments